PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.1131s0040.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family GRAS
Protein Properties Length: 594aa    MW: 65187.5 Da    PI: 4.6799
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.1131s0040.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS354.22e-1082265933374
                    GRAS   3 elLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsP 89 
                             ++L+ecA+ v+s+  + a + L + ++ +s++g p++R+ +yf+e+L +r+a     + k     + ++++s+e + ++k++++++P
  SapurV1A.1131s0040.2.p 226 KALVECAQLVESKADQ-AVKSLVKFKDSVSENGGPVERVGFYFAEGLCRRVAARELDVLK-----NFDQTTSEEFTLSYKALNDACP 306
                             79********996655.55667789***************************94444443.....33333478999*********** PP

                    GRAS  90 ilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegpp.slRiTgvgspesg..skeeleetgerLakfAeelg 173
                             + kf+hltaNqaIlea+e+++++Hi+Df+i qG+QW+aLlqaLa+R++g+p ++Ri g+ +p  g   + +l +tg+rL +fA+ l+
  SapurV1A.1131s0040.2.p 307 YSKFAHLTANQAILEATEKASKIHIVDFGIVQGVQWAALLQALATRSAGKPvRIRISGIPAPVLGknPAASLLATGNRLLDFAKLLD 393
                             ***********************************************88777*********9988889999**************** PP

                    GRAS 174 vpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflea 260
                             ++fef++ + + +++l+ + +rv+p+E+laVn++lql++lldes    +   + Lk+ ksl+Pk+v++ e e+ +n+  +l+rf +a
  SapurV1A.1131s0040.2.p 394 LNFEFEP-ILTPIQELNESCFRVEPDEVLAVNFMLQLYNLLDESPVAVE---TALKMAKSLNPKIVTLGEYEVCLNRVGYLTRFKNA 476
                             *******.799******************************99988888...9********************************** PP

                    GRAS 261 leyysalfdsleaklpreseerikvErellgreivnvvacegae.rrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk. 345
                             l+yy+a+f+sle +l+r+s er  vEr llg +i++vv  e+   rrer+e + +W + +e++GF++v+ls++a++qak ll +++ 
  SapurV1A.1131s0040.2.p 477 LRYYTAVFESLEPNLSRDSPERLRVERLLLGHRISSVVGPEEPGvRRERMEDKDQWGALMESSGFESVSLSHYATSQAKILLWNYNy 563
                             ****************************************99988*****************************************9 PP

                    GRAS 346 sdgyrveeesgslv.lgWkdrpLvsvSaWr 374
                             s  y++++++  ++ l W+d pL++vS+Wr
  SapurV1A.1131s0040.2.p 564 SALYSIDDSQPGFLtLAWNDVPLLTVSSWR 593
                             999****99877777**************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098557.393198571IPR005202Transcription factor GRAS
PfamPF035147.0E-106226593IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 594 aa     Download sequence    Send to blast
MAYMCADSGN LMAIAQQVIK QKQQQEQQQQ QSHHHNQQQQ LLGLNPFSLN PWPTNIMSVN  60
PNLGYGLSGP AAFSDPFQNG QDTGDPPGFN FSNMEQNHSS GFRLPYFTGA GGEFDSDEWM  120
DSLMNGGDST DSSNLPSGCD AWQNSTDFGM YTSDPFNTVP SRLAVGCSPP SDLNGVISNS  180
LWAAPSPPEE IKPTTSPPPL PLPTVKNEVV GGSKEIAQLS SSPVLKALVE CAQLVESKAD  240
QAVKSLVKFK DSVSENGGPV ERVGFYFAEG LCRRVAAREL DVLKNFDQTT SEEFTLSYKA  300
LNDACPYSKF AHLTANQAIL EATEKASKIH IVDFGIVQGV QWAALLQALA TRSAGKPVRI  360
RISGIPAPVL GKNPAASLLA TGNRLLDFAK LLDLNFEFEP ILTPIQELNE SCFRVEPDEV  420
LAVNFMLQLY NLLDESPVAV ETALKMAKSL NPKIVTLGEY EVCLNRVGYL TRFKNALRYY  480
TAVFESLEPN LSRDSPERLR VERLLLGHRI SSVVGPEEPG VRRERMEDKD QWGALMESSG  540
FESVSLSHYA TSQAKILLWN YNYSALYSID DSQPGFLTLA WNDVPLLTVS SWR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-1482215931375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ5118630.0KJ511863.1 Populus euphratica GRAS/SCL transcription factor (SCL7) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002310226.20.0hypothetical protein POPTR_0007s12760g
SwissprotQ9FL030.0SCL4_ARATH; Scarecrow-like protein 4
TrEMBLB9HEW40.0B9HEW4_POPTR; Uncharacterized protein
STRINGPOPTR_0007s12760.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66770.10.0GRAS family protein